Structure of PDB 1u0c Chain B

Receptor sequence

>1u0cB (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSCKFKHQLSLTFQVTEKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD

3D structure

PDB

1u0c Isolation and characterization of new homing endonuclease specificities at individual target site positions.

Chain

Resolution

2.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	G319 D320
Catalytic site (residue number reindexed from 1)	G18 D19
Enzyme Commision number	3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S332 C333 K334 Q338 Y366 R368 R370 E380 I381 K416 D437 K439 T440	S31 C32 K33 Q37 Y65 R67 R69 E79 I80 K115 D136 K138 T139	PDBbind-CN: Kd=25nM
BS02	dna	B	G319 D320 G321 S322 Q326 K328 T346 E347 K348 R370 V373 K398 A433 N436 D437 S438 R441 K442	G18 D19 G20 S21 Q25 K27 T45 E46 K47 R69 V72 K97 A132 N135 D136 S137 R140 K141	PDBbind-CN: Kd=25nM

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006314	intron homing

	Cellular Component
GO:0009507	chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1u0c, PDBe:1u0c, PDBj:1u0c
PDBsum	1u0c
PubMed	15313605
UniProt	P05725\|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]