Structure of PDB 1typ Chain B

Receptor sequence

>1typB (length=486) Species: 5656 (Crithidia fasciculata) [Search protein sequence]

SRAYDLVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGT
CVNVGCVPKKLMVTGANYMDTIRESAGFGWELDRESVRPNWKALIAAKNK
AVSGINDSYEGMFADTEGLTFHQGWGALQDNHTVLVRESADPNSAVLETL
DTEYILLATGSWPQHLGIEGDDLCITSNEAFYLDEAPKRALCVGGGYISI
EFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRT
HENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLDKAGV
EVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFA
NKPRATDHTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMH
NISGSTYKKFMVRIVTNHADGEVLGVHMLGDSSPEIIQSVAICLKMGAKI
SDFYNTIGVHPTSAEELCSMRTPAYFYQKGKRVEKI

3D structure

PDB

1typ Substrate interactions between trypanothione reductase and N1-glutathionylspermidine disulphide at 0.28-nm resolution.

Chain

Resolution

2.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	S14 L48 C52 C57 K60 R85 E86 Y198 E202 I339 G459 H461 E466 E485 K486
Catalytic site (residue number reindexed from 1)	S13 L47 C51 C56 K59 R84 E85 Y197 E201 I338 G458 H460 E465 E484 K485
Enzyme Commision number	1.8.1.12: trypanothione-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GSH	B	H461 S470	H460 S469
BS02	GSH	B	H461 T463	H460 T462
BS03	FAD	B	G11 G15 D35 G50 T51 C52 V55 G56 C57 K60 G127 T160 G161 Y198 R287 R290 D327 L334 T335	G10 G14 D34 G49 T50 C51 V54 G55 C56 K59 G126 T159 G160 Y197 R286 R289 D326 L333 T334
BS04	NAP	B	G196 Y198 I199 Y221 R222 R228 I285 G286 R287 M333 L334 C364	G195 Y197 I198 Y220 R221 R227 I284 G285 R286 M332 L333 C363
BS05	GSH	B	S14 I339	S13 I338
BS06	SPD	B	L17 E18 W21	L16 E17 W20

Gene Ontology

	Molecular Function
GO:0004362	glutathione-disulfide reductase (NADPH) activity
GO:0015036	disulfide oxidoreductase activity
GO:0015042	trypanothione-disulfide reductase (NADPH) activity
GO:0016491	oxidoreductase activity
GO:0016668	oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0050660	flavin adenine dinucleotide binding

	Biological Process
GO:0006749	glutathione metabolic process
GO:0034599	cellular response to oxidative stress
GO:0045454	cell redox homeostasis
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1typ, PDBe:1typ, PDBj:1typ
PDBsum	1typ
PubMed	8477734
UniProt	P39040\|TYTR_CRIFA Trypanothione reductase (Gene Name=TPR)

[Back to BioLiP]