Structure of PDB 1tef Chain B |
>1tefB (length=99) Species: 3562 (Spinacia oleracea) [Search protein sequence] |
VEVLLGGDDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGV DAAKISMSEEDLLNAPGECYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN |
|
PDB | 1tef Novel Disulfide Bonds Effect the Thermostability of Plastocyanin. Crystal structures of the triple plastocyanin mutant G8D/K30C/T69C and the double plastocyanin mutant K30C/T69C from spinach at 1.90 and 1.96 resolution, respectively. |
Chain | B |
Resolution | 1.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
H37 C84 H87 M92 |
H37 C84 H87 M92 |
|
|
|
|