Structure of PDB 1tcx Chain B |
>1tcxB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEEMSLPGRWKPKMVGGI GGFIKVRQYDQILIEICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF |
|
PDB | 1tcx Human immunodeficiency virus protease ligand specificity conferred by residues outside of the active site cavity. |
Chain | B |
Resolution | 2.3 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
IM1 |
B |
D25 G27 G49 |
D25 G27 G49 |
PDBbind-CN: -logKd/Ki=6.95,Ki=112nM |
|
|
|