Structure of PDB 1taf Chain B |
>1tafB (length=70) Species: 7227 (Drosophila melanogaster) [Search protein sequence] |
MLYGSSISAESMKVIAESIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKF MNHAKRQKLSVRDIDMSLKV |
|
PDB | 1taf Structural similarity between TAFs and the heterotetrameric core of the histone octamer. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
E31 D35 |
E31 D35 |
|
|
|
|