Structure of PDB 1t9j Chain B

Receptor sequence
>1t9jB (length=151) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
TKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTEKTQRR
WFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQA
NLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVL
D
3D structure
PDB1t9j Metal-Dependent DNA Cleavage Mechanism of the I-CreI LAGLIDADG Homing Endonuclease.
ChainB
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G319 D320
Catalytic site (residue number reindexed from 1) G17 D18
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S332 Y333 K334 Q338 R368 R370 I381 K416 D437 K439 S30 Y31 K32 Q36 R66 R68 I79 K114 D135 K137 PDBbind-CN: Kd=0.6nM
BS02 dna B G319 D320 G321 S322 I324 Q326 K328 Q344 T346 E347 K348 R370 K398 N436 D437 S438 R441 K442 G17 D18 G19 S20 I22 Q24 K26 Q42 T44 E45 K46 R68 K96 N134 D135 S136 R139 K140 PDBbind-CN: Kd=0.6nM
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1t9j, PDBe:1t9j, PDBj:1t9j
PDBsum1t9j
PubMed15518550
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]