Structure of PDB 1sxb Chain B

Receptor sequence
>1sxbB (length=151) Species: 9913 (Bos taurus) [Search protein sequence]
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGD
NTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDP
LISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIA
K
3D structure
PDB1sxb Crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 A resolution.
ChainB
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H44 H46 H61 H69 H78 D81 H118 R141
Catalytic site (residue number reindexed from 1) H44 H46 H61 H69 H78 D81 H118 R141
Enzyme Commision number 1.15.1.1: superoxide dismutase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU B H44 H46 H61 H118 H44 H46 H61 H118
BS02 ZN B H61 H69 H78 D81 H61 H69 H78 D81
Gene Ontology
Molecular Function
GO:0004784 superoxide dismutase activity
GO:0004842 ubiquitin-protein transferase activity
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0030346 protein phosphatase 2B binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0051087 protein-folding chaperone binding
Biological Process
GO:0000209 protein polyubiquitination
GO:0000303 response to superoxide
GO:0001541 ovarian follicle development
GO:0001819 positive regulation of cytokine production
GO:0001895 retina homeostasis
GO:0002262 myeloid cell homeostasis
GO:0006749 glutathione metabolic process
GO:0006801 superoxide metabolic process
GO:0006879 intracellular iron ion homeostasis
GO:0007283 spermatogenesis
GO:0007566 embryo implantation
GO:0007605 sensory perception of sound
GO:0007626 locomotory behavior
GO:0008217 regulation of blood pressure
GO:0009408 response to heat
GO:0019226 transmission of nerve impulse
GO:0019430 removal of superoxide radicals
GO:0032287 peripheral nervous system myelin maintenance
GO:0040014 regulation of multicellular organism growth
GO:0042542 response to hydrogen peroxide
GO:0043085 positive regulation of catalytic activity
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043410 positive regulation of MAPK cascade
GO:0043524 negative regulation of neuron apoptotic process
GO:0045471 response to ethanol
GO:0046716 muscle cell cellular homeostasis
GO:0048678 response to axon injury
GO:0050665 hydrogen peroxide biosynthetic process
GO:0051881 regulation of mitochondrial membrane potential
GO:0060047 heart contraction
GO:0060052 neurofilament cytoskeleton organization
GO:0060087 relaxation of vascular associated smooth muscle
GO:0060088 auditory receptor cell stereocilium organization
GO:0072593 reactive oxygen species metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005777 peroxisome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0031410 cytoplasmic vesicle
GO:0032839 dendrite cytoplasm
GO:0032991 protein-containing complex
GO:0043025 neuronal cell body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1sxb, PDBe:1sxb, PDBj:1sxb
PDBsum1sxb
PubMed7643403
UniProtP00442|SODC_BOVIN Superoxide dismutase [Cu-Zn] (Gene Name=SOD1)

[Back to BioLiP]