Structure of PDB 1sum Chain B

Receptor sequence
>1sumB (length=225) Species: 2336 (Thermotoga maritima) [Search protein sequence]
NRLLNEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEV
VDQMEVEIQEKAMEVLGLFSPIGKPLLTVTAGIRVAELIENIADKCHDIA
KNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADVNVEKSFEVCRM
DSKVDDLYEKVREELLLYMMESPKYVKRALLLLEIAGNIEIIADYATNIV
EVSVYMVQGEAYKCYHDELLLFKKS
3D structure
PDB1sum Crystal structure of a PhoU protein homologue: a new class of metalloprotein containing multinuclear iron clusters.
ChainB
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FE B E7 E11 E6 E10
BS02 FE B E49 D53 E91 D95 E48 D52 E90 D94
BS03 FE B E91 N92 D95 E90 N91 D94
BS04 FE B E56 E88 E91 E55 E87 E90
BS05 FE B D152 D156 E191 D195 D151 D155 E190 D194
BS06 FE B E191 D195 E190 D194
BS07 FE B D152 D156 D151 D155
BS08 PO3 B D156 D195 D155 D194
BS09 PO3 B D53 E91 D95 D52 E90 D94
Gene Ontology
Molecular Function
GO:0042803 protein homodimerization activity
Biological Process
GO:0006817 phosphate ion transport
GO:0030643 intracellular phosphate ion homeostasis
GO:0045936 negative regulation of phosphate metabolic process
GO:2000186 negative regulation of phosphate transmembrane transport
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1sum, PDBe:1sum, PDBj:1sum
PDBsum1sum
PubMed15716271
UniProtQ9X256|PHOU2_THEMA Phosphate-specific transport system accessory protein PhoU homolog 2 (Gene Name=phoU2)

[Back to BioLiP]