Structure of PDB 1sr6 Chain B |
>1sr6B (length=144) Species: 31199 (Argopecten irradians) [Search protein sequence] |
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKE APGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDL LENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA |
|
PDB | 1sr6 Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding. |
Chain | B |
Resolution | 2.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
D30 D32 F34 V35 |
D18 D20 F22 V23 |
|
|
|
|