Structure of PDB 1so0 Chain B

Receptor sequence

>1so0B (length=342) Species: 9606 (Homo sapiens)

MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQG
RASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAIN
KEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTY
TLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADT
YLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKG
SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA

3D structure

• PDB: 1so0 Molecular structure of human galactose mutarotase
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H107 H176 E307
• Catalytic site (residue number reindexed from 1): H107 H176 E307
• Enzyme Commision number: 5.1.3.3: aldose 1-epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GAL	B	N81 R82 H107 H176 D243 E307	N81 R82 H107 H176 D243 E307

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004034 aldose 1-epimerase activity
• GO:0016853 isomerase activity
• GO:0030246 carbohydrate binding
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0006006 glucose metabolic process
• GO:0006012 galactose metabolic process
• GO:0019318 hexose metabolic process
• GO:0033499 galactose catabolic process via UDP-galactose

Cellular Component

• GO:0005737 cytoplasm
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1so0, PDBe:1so0, PDBj:1so0
• PDBsum: 1so0
• PubMed: 15026423
• UniProt: Q96C23|GALM_HUMAN Galactose mutarotase (Gene Name=GALM)