Structure of PDB 1shr Chain B

Receptor sequence

>1shrB (length=146) Species: 9606 (Homo sapiens)

VHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSS
PDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDP
ENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH

3D structure

• PDB: 1shr Crystal structures of HbA2 and HbE and modeling of hemoglobin delta4: interpretation of the thermal stability and the antisickling effect of HbA2 and identification of the ferrocyanide binding site in Hb
• Chain: B
• Resolution: 1.88 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CYN	B	H63 V67	H63 V67
BS02	FE	B	H143 H146	H143 H146
BS03	CYN	B	K82 H143	K82 H143
BS04	CYN	B	H143 H146	H143 H146
BS05	HEM	B	T38 F41 F42 H63 F71 L88 H92 L96 V98 N102 F103 L106 L141	T38 F41 F42 H63 F71 L88 H92 L96 V98 N102 F103 L106 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005515 protein binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015670 carbon dioxide transport
• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005829 cytosol
• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:1shr, PDBe:1shr, PDBj:1shr
• PDBsum: 1shr
• PubMed: 15449937
• UniProt: P02042|HBD_HUMAN Hemoglobin subunit delta (Gene Name=HBD)