Structure of PDB 1sed Chain B |
>1sedB (length=110) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
MDHRIERLEYYIQLLVKTVDMDRYPFYALLIDKGLSKEEGEAVMRICDEL SEELATQKAQGFVTFDKLLALFAGQLNEKLDVHETIFALYEQGLYQELME VFIDIMKHFD |
|
PDB | 1sed The Crystal Structure of the Hypothetical Protein YhaI, APC1180 from Bacillus subtilis |
Chain | B |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
E52 E55 |
E49 E52 |
|
|
|