Structure of PDB 1scm Chain B

Receptor sequence

>1scmB (length=138) Species: 31199 (Argopecten irradians)

LPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLK
EAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKD
LLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIK

3D structure

• PDB: 1scm Structure of the regulatory domain of scallop myosin at 2.8 A resolution.
• Chain: B
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	D28 D30 D32 F34 D39	D17 D19 D21 F23 D28

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0032036 myosin heavy chain binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0005737 cytoplasm
• GO:0016459 myosin complex
• GO:0016460 myosin II complex

External links

• PDB: RCSB:1scm, PDBe:1scm, PDBj:1scm
• PDBsum: 1scm
• PubMed: 8127365
• UniProt: P13543|MLR_ARGIR Myosin regulatory light chain, striated adductor muscle