Structure of PDB 1rwv Chain B |
>1rwvB (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] |
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDV EEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH |
|
PDB | 1rwv Novel Caspase-1 Inhibitors Discovered Using Tethering(SM) with Extenders |
Chain | B |
Resolution | 2.1 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
E390 |
Catalytic site (residue number reindexed from 1) |
E74 |
Enzyme Commision number |
3.4.22.36: caspase-1. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5PH |
B |
S339 W340 R341 P343 |
S23 W24 R25 P27 |
|
|
|
|