Structure of PDB 1rv7 Chain B |
>1rv7B (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGI GGFVKVRQYDQVPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF |
|
PDB | 1rv7 Crystal structures of a multidrug-resistant human immunodeficiency virus type 1 protease reveal an expanded active-site cavity. |
Chain | B |
Resolution | 2.7 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
N25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
N25 T26 G27 |
Enzyme Commision number |
3.4.23.16: HIV-1 retropepsin. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
AB1 |
B |
T80 P81 A82 V84 |
T80 P81 A82 V84 |
|
|
|
|