Structure of PDB 1rrg Chain B

Receptor sequence
>1rrgB (length=177) Species: 10116 (Rattus norvegicus) [Search protein sequence]
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGF
NVETVEYKNISFTVWDVGGIRPLWRHYFQNTQGLIFVVDSNDRERVNEAR
EELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWY
IQATCATSGDGLYEGLDWLSNQLRNQK
3D structure
PDB1rrg The structure of rat ADP-ribosylation factor-1 (ARF-1) complexed to GDP determined from two different crystal forms.
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP B A27 G29 K30 T31 T32 N126 K127 D129 C159 A160 A26 G28 K29 T30 T31 N122 K123 D125 C155 A156
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0019904 protein domain specific binding
GO:1990583 phospholipase D activator activity
Biological Process
GO:0002090 regulation of receptor internalization
GO:0006878 intracellular copper ion homeostasis
GO:0006886 intracellular protein transport
GO:0007015 actin filament organization
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0034315 regulation of Arp2/3 complex-mediated actin nucleation
GO:0034379 very-low-density lipoprotein particle assembly
GO:0045807 positive regulation of endocytosis
GO:0045956 positive regulation of calcium ion-dependent exocytosis
GO:0050714 positive regulation of protein secretion
GO:0055108 Golgi to transport vesicle transport
GO:0060292 long-term synaptic depression
GO:0060999 positive regulation of dendritic spine development
GO:0070142 synaptic vesicle budding
GO:0097061 dendritic spine organization
GO:0097212 lysosomal membrane organization
GO:0098974 postsynaptic actin cytoskeleton organization
GO:1902307 positive regulation of sodium ion transmembrane transport
GO:1902824 positive regulation of late endosome to lysosome transport
GO:1902953 positive regulation of ER to Golgi vesicle-mediated transport
GO:1903725 regulation of phospholipid metabolic process
GO:1990386 mitotic cleavage furrow ingression
Cellular Component
GO:0000139 Golgi membrane
GO:0005770 late endosome
GO:0005778 peroxisomal membrane
GO:0005794 Golgi apparatus
GO:0005802 trans-Golgi network
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0012505 endomembrane system
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030017 sarcomere
GO:0030137 COPI-coated vesicle
GO:0031252 cell leading edge
GO:0032991 protein-containing complex
GO:0043005 neuron projection
GO:0045202 synapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1rrg, PDBe:1rrg, PDBj:1rrg
PDBsum1rrg
PubMed7552752
UniProtP84079|ARF1_RAT ADP-ribosylation factor 1 (Gene Name=Arf1)

[Back to BioLiP]