Structure of PDB 1rqq Chain B

Receptor sequence

>1rqqB (length=297) Species: 9606 (Homo sapiens)

DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESA
SLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKS
YLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAAR
NCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVF
TTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPE
RVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK

3D structure

• PDB: 1rqq Structural basis for recruitment of the adaptor protein APS to the activated insulin receptor.
• Chain: B
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D1132 A1134 R1136 N1137 D1150 E1159 L1171
• Catalytic site (residue number reindexed from 1): D146 A148 R150 N151 D164 E173 L185
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	Q1004 R1136 K1168 G1169 L1170 L1171 V1173 W1175 L1181 K1182 D1183 G1184 N1215 M1223	Q18 R150 K182 G183 L184 L185 V187 W189 L195 K196 D197 G198 N229 M237
BS02	MN	B	N1137 D1150	N151 D164
BS03	112	B	Q1004 G1005 S1006 V1010 A1028 K1030 M1076 E1077 M1079 D1132 R1136 N1137 M1139 D1150	Q18 G19 S20 V24 A42 K44 M90 E91 M93 D146 R150 N151 M153 D164

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:1rqq, PDBe:1rqq, PDBj:1rqq
• PDBsum: 1rqq
• PubMed: 14690593
• UniProt: P06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)