Structure of PDB 1rpu Chain B

Receptor sequence
>1rpuB (length=136) Species: 39443 (Carnation Italian ringspot virus) [Search protein sequence]
NDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDENPLGFKESW
GFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLGANQVGCTYS
IRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTP
3D structure
PDB1rpu Size selective recognition of siRNA by an RNA silencing suppressor
ChainB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B R18 W39 W42 K60 Y73 Q107 V108 G109 S124 G125 G126 R11 W32 W35 K47 Y60 Q94 V95 G96 S111 G112 G113 PDBbind-CN: Kd=0.17nM
BS02 rna B W39 T40 S62 K67 V69 T111 S113 R115 S120 T122 W32 T33 S49 K54 V56 T98 S100 R102 S107 T109 PDBbind-CN: Kd=0.17nM
Gene Ontology
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0052170 symbiont-mediated suppression of host innate immune response
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1rpu, PDBe:1rpu, PDBj:1rpu
PDBsum1rpu
PubMed14697199
UniProtQ66104|P19_CIRV RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]