Structure of PDB 1rfk Chain B

Receptor sequence

>1rfkB (length=97) Species: 83541 (Mastigocladus laminosus)

ATYKVTLINEAEGLNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCA
GKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEEL

3D structure

• PDB: 1rfk Structural basis for the thermostability of ferredoxin from the cyanobacterium Mastigocladus laminosus.
• Chain: B
• Resolution: 1.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	B	Y239 C241 R242 G244 C246 C249 C279	Y39 C41 R42 G44 C46 C49 C79

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0022900 electron transport chain

External links

• PDB: RCSB:1rfk, PDBe:1rfk, PDBj:1rfk
• PDBsum: 1rfk
• PubMed: 15961101
• UniProt: P00248|FER_MASLA Ferredoxin (Gene Name=petF)