Structure of PDB 1re1 Chain B |
>1re1B (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] |
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHI LTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY |
|
PDB | 1re1 Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
3.4.22.56: caspase-3. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NA3 |
B |
Y338 S339 W340 R341 |
Y19 S20 W21 R22 |
PDBbind-CN: -logKd/Ki=5.21,IC50=6117nM BindingDB: IC50=6000nM |
|
|
|