Structure of PDB 1r0o Chain B

Receptor sequence
>1r0oB (length=78) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
EELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDM
YMRRKCQECRLKKCLAVGMRPECVVPEN
3D structure
PDB1r0o Structure of the Heterodimeric Ecdysone Receptor DNA-binding Complex
ChainB
Resolution2.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B E25 G26 R33 R56 R57 Q60 R63 E22 G23 R30 R53 R54 Q57 R60
BS02 dna B Y17 H18 Y19 K28 R32 K58 V78 Y14 H15 Y16 K25 R29 K55 V75
BS03 ZN B C7 C10 C27 C4 C7 C24
BS04 ZN B C43 C49 C59 C62 C40 C46 C56 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1r0o, PDBe:1r0o, PDBj:1r0o
PDBsum1r0o
PubMed14592980
UniProtP34021|ECR_DROME Ecdysone receptor (Gene Name=EcR)

[Back to BioLiP]