Structure of PDB 1r0n Chain B

Receptor sequence
>1r0nB (length=86) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMY
MRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK
3D structure
PDB1r0n Structure of the heterodimeric Ecdysone Receptor DNA-binding complex
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B E219 F224 R227 R250 Q254 R257 E21 F26 R29 R52 Q56 R59
BS02 dna B Y211 Y213 K222 R226 R251 V272 K280 Y13 Y15 K24 R28 R53 V74 K82
BS03 ZN B C201 C204 C218 C221 C3 C6 C20 C23
BS04 ZN B C243 C253 C256 C45 C55 C58
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1r0n, PDBe:1r0n, PDBj:1r0n
PDBsum1r0n
PubMed14592980
UniProtP34021|ECR_DROME Ecdysone receptor (Gene Name=EcR)

[Back to BioLiP]