Structure of PDB 1qn4 Chain B

Receptor sequence

>1qn4B (length=187) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

VDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVI
MRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFK
DFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIV
LLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI

3D structure

PDB

1qn4 TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution

Chain

Resolution

1.86 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	V29 A58 F74 S76 K78 V80 Q116 N117 L147 F148 I152 R154 L163 T173	V18 A47 F63 S65 K67 V69 Q105 N106 L136 F137 I141 R143 L152 T162
BS02	dna	B	Q26 N27 R56 F57 R63 T70 T82 V119 F148 P149 F165 S167 K169 V171	Q15 N16 R45 F46 R52 T59 T71 V108 F137 P138 F154 S156 K158 V160

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1qn4, PDBe:1qn4, PDBj:1qn4
PDBsum	1qn4
PubMed	10617571
UniProt	P28147\|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]