Structure of PDB 1qm6 Chain B

Receptor sequence

>1qm6B (length=370) Species: 1502 (Clostridium perfringens)

WDGKIDGTGTHAMIVTQGVSILENDLSKNEPESVRKNLEILKENMHELQL
GSTYPDYDKNAYDLYQDHFWDPDTDNNFSKDNSWYLAYSIPDTGESQIRK
FSALARYEWQRGNYKQATFYLGEAMHYFGDIDTPYHPANVTAVDSAGHVK
FETFAEERKEQYKINTAGCKTNEAFYTDILKNKDFNAWSKEYARGFAKTG
KSIYYSHASMSHSWDDWDYAAKVTLANSQKGTAGYIYRFLHDVSEGNDPS
VGKNVKELVAYISTSGEKDAGTDDYMYFGIKTKDGKTQEWEMDNPGNDFM
TGSKDTYTFKLKDENLKIDDIQNMWIRKRKYTAFSDAYKPENIKIIANGK
VVVDKDINEWISGNSTYNIK

3D structure

• PDB: 1qm6 Characterisation of the Calcium-Binding C-Terminal Domain of Clostridium Perfringens Alpha-Toxin
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H11 D56 H68 H126 D130 H136 H148 E152
• Catalytic site (residue number reindexed from 1): H11 D56 H68 H126 D130 H136 H148 E152
• Enzyme Commision number: 3.1.4.3: phospholipase C.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	W1 H11 D130	W1 H11 D130
BS02	ZN	B	D56 H68 H126 D130	D56 H68 H126 D130

Gene Ontology

Molecular Function

• GO:0004629 phospholipase C activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0016788 hydrolase activity, acting on ester bonds
• GO:0034480 phosphatidylcholine phospholipase C activity
• GO:0046872 metal ion binding
• GO:0090729 toxin activity

Biological Process

• GO:0031640 killing of cells of another organism
• GO:0035821 modulation of process of another organism
• GO:0044179 hemolysis in another organism

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1qm6, PDBe:1qm6, PDBj:1qm6
• PDBsum: 1qm6
• PubMed: 10610794
• UniProt: Q0TV31|PHLC_CLOP1 Phospholipase C (Gene Name=plc)