Structure of PDB 1q4v Chain B

Receptor sequence

>1q4vB (length=30) Species: 9606 (Homo sapiens)

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

3D structure

• PDB: 1q4v Crystal structure of allo-Ile(A2)-insulin, an inactive chiral analogue: implications for the mechanism of receptor binding.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	F1 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 T27	F1 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 T27

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1q4v, PDBe:1q4v, PDBj:1q4v
• PDBsum: 1q4v
• PubMed: 14596591
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)