Structure of PDB 1q05 Chain B |
>1q05B (length=127) Species: 562 (Escherichia coli) [Search protein sequence] |
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLL RQARQVGFNLEESGELVNLFNDPQHSADVKRRTLEKVAEIERHIEELQSM RDQLLALANACPGDDSADCPIIENLSG |
|
PDB | 1q05 Molecular basis of metal-ion selectivity and zeptomolar sensitivity by CueR |
Chain | B |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
B |
C112 C120 |
C111 C119 |
|
|
|
|