Structure of PDB 1pvp Chain B

Receptor sequence

>1pvpB (length=318) Species: 10678 (Punavirus P1)

TSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEP
EDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMR
RIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAY
NTLLRAAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVT
KLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSLSALHGIFGAT
HRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNV
NIVMNYIRTGAMVRLLED

3D structure

• PDB: 1pvp A specificity switch in selected cre recombinase variants is mediated by macromolecular plasticity and water.
• Chain: B
• Resolution: 2.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	K43 M44 S47 R50 R81 L83 A84 K86 T87 Q90 A131 K132 R154 Q156 R159 R173 K201 T202 R241 V242 K244 L256 S257 S259 A260 R282 Y283 W315 T316 N317 I320 Y324	K25 M26 S29 R32 R63 L65 A66 K68 T69 Q72 A113 K114 R136 Q138 R141 R155 K183 T184 R223 V224 K226 L238 S239 S241 A242 R264 Y265 W297 T298 N299 I302 Y306
BS02	dna	B	S38 H40 T41 Q90 M97 R106 R121 A175 K201 R243 N245 H262 R282 Y283 S287 G288 H289	S20 H22 T23 Q72 M79 R88 R103 A157 K183 R225 N227 H244 R264 Y265 S269 G270 H271

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

Biological Process

• GO:0006310 DNA recombination
• GO:0015074 DNA integration

External links

• PDB: RCSB:1pvp, PDBe:1pvp, PDBj:1pvp
• PDBsum: 1pvp
• PubMed: 14652076
• UniProt: P06956|RECR_BPP1 Recombinase cre (Gene Name=cre)