Structure of PDB 1pob Chain B

Receptor sequence
>1pobB (length=118) Species: 8656 (Naja atra) [Search protein sequence]
NLYQFKNMIQCTVPSRSWWDFADYGCYCGRGGSGTPVDDLDRCCQVHDNC
YNEAEKISGCWPYFKTYSYECSQGTLTCKGGNNACAAAVCDCDRLAAICF
AGAPYNDNDYNINLKARC
3D structure
PDB1pob Crystal structure of cobra-venom phospholipase A2 in a complex with a transition-state analogue.
ChainB
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y27 G29 G31 H47 D48 Y51 Y67 D93
Catalytic site (residue number reindexed from 1) Y27 G29 G31 H47 D48 Y51 Y67 D93
Enzyme Commision number 3.1.1.4: phospholipase A2.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA B Y27 G29 G31 D48 Y27 G29 G31 D48
BS02 CA B Y24 G25 C26 Y27 C28 Y24 G25 C26 Y27 C28
BS03 GEL B L2 G29 G31 C44 H47 D48 Y51 N52 Y63 L2 G29 G31 C44 H47 D48 Y51 N52 Y63
Gene Ontology
Molecular Function
GO:0004623 phospholipase A2 activity
GO:0005509 calcium ion binding
GO:0005543 phospholipid binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0047498 calcium-dependent phospholipase A2 activity
GO:0090729 toxin activity
Biological Process
GO:0006644 phospholipid metabolic process
GO:0016042 lipid catabolic process
GO:0035821 modulation of process of another organism
GO:0050482 arachidonate secretion
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1pob, PDBe:1pob, PDBj:1pob
PDBsum1pob
PubMed2274787
UniProtP00598|PA2A1_NAJAT Acidic phospholipase A2 1

[Back to BioLiP]