Structure of PDB 1p6n Chain B

Receptor sequence

>1p6nB (length=404) Species: 9913 (Bos taurus)

KFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLVLPRPPAEQLLSQ
ARDFINQYYSSIKRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQ
AWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRS
AITVFPQRAPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQ
HGWTPGNGRFDVLPLLLQAPDEAPELFVLPPELVLEVPLEHPTLEWFAAL
GLRWYALPAVSNMLLEIGGLEFSAAPFSGWYMSTEIGTRNLCDPHRYNIL
EDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSFQLAKVTIVDHHAATVS
FMKHLDNEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRYQ
PDPW

3D structure

• PDB: 1p6n Structural basis for dipeptide amide isoform-selective inhibition of neuronal nitric oxide synthase.
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C186 R189 W358 E363
• Catalytic site (residue number reindexed from 1): C108 R111 W280 E285
• Enzyme Commision number: 1.14.13.39: nitric-oxide synthase (NADPH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	H4B	B	F462 H463 Q464 E465	F384 H385 Q386 E387
BS02	ZN	B	C96 C101	C28 C33
BS03	HEM	B	W180 C186 G188 F355 S356 W358 E363 W449 F475 Y477	W102 C108 G110 F277 S278 W280 E285 W371 F397 Y399
BS04	H4B	B	S104 R367 A448 W449	S36 R289 A370 W371
BS05	DP9	B	Q249 P336 S356 G357 W358 E363 Y477	Q171 P258 S278 G279 W280 E285 Y399	MOAD: Ki=110uM BindingDB: IC50=29000nM,Ki=128000nM

Gene Ontology

Molecular Function

• GO:0004517 nitric-oxide synthase activity
• GO:0020037 heme binding

Biological Process

• GO:0006809 nitric oxide biosynthetic process

External links

• PDB: RCSB:1p6n, PDBe:1p6n, PDBj:1p6n
• PDBsum: 1p6n
• PubMed: 14718923
• UniProt: P29473|NOS3_BOVIN Nitric oxide synthase 3 (Gene Name=NOS3)