Structure of PDB 1ozb Chain B |
>1ozbB (length=137) Species: 727 (Haemophilus influenzae) [Search protein sequence] |
QPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDDLYE VVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNM LFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMN |
|
PDB | 1ozb Structural determinants of SecB recognition by SecA in bacterial protein translocation |
Chain | B |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
D27 S29 E31 |
D13 S15 E17 |
|
|
|
|