Structure of PDB 1ox7 Chain B

Receptor sequence

>1ox7B (length=161) Species: 4932 (Saccharomyces cerevisiae)

GSSMVTGGMASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLG
RGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGA
IIMYGIPRCVVGENVNFKSKGEKYLQTRGHEVVVVDDERCKKIMKQFIDE
RPQDWFEDIGE

3D structure

• PDB: 1ox7 The 1.14 a crystal structure of yeast Cytosine deaminase. Evolution of nucleotide salvage enzymes and implications for genetic chemotherapy.
• Chain: B
• Resolution: 1.43 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H262 E264 S289 C291 C294
• Catalytic site (residue number reindexed from 1): H65 E67 S92 C94 C97
• Enzyme Commision number: 3.5.4.1: cytosine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	H262 C291 C294	H65 C94 C97

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004131 cytosine deaminase activity
• GO:0008270 zinc ion binding
• GO:0008835 diaminohydroxyphosphoribosylaminopyrimidine deaminase activity
• GO:0016787 hydrolase activity
• GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
• GO:0019239 deaminase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008655 pyrimidine-containing compound salvage
• GO:0019858 cytosine metabolic process
• GO:0034654 nucleobase-containing compound biosynthetic process
• GO:0044206 UMP salvage
• GO:0046087 cytidine metabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:1ox7, PDBe:1ox7, PDBj:1ox7
• PDBsum: 1ox7
• PubMed: 12906827
• UniProt: Q12178|FCY1_YEAST Cytosine deaminase (Gene Name=FCY1)