Structure of PDB 1owg Chain B

Receptor sequence
>1owgB (length=94) Species: 562 (Escherichia coli) [Search protein sequence]
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGS
FSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG
3D structure
PDB1owg Integration Host Factor: putting a twist on protein-DNA recognition
ChainB
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S4 K27 E44 R46 G47 S50 R59 R62 N63 P64 K75 G83 K84 S4 K27 E44 R46 G47 S50 R59 R62 N63 P64 K75 G83 K84 PDBbind-CN: Kd=200nM
BS02 dna B E44 R46 H54 R56 H79 E44 R46 H54 R56 H79 PDBbind-CN: Kd=200nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
Cellular Component
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1owg, PDBe:1owg, PDBj:1owg
PDBsum1owg
PubMed12842466
UniProtP0A6Y1|IHFB_ECOLI Integration host factor subunit beta (Gene Name=ihfB)

[Back to BioLiP]