Structure of PDB 1ovw Chain B

Receptor sequence

>1ovwB (length=398) Species: 5507 (Fusarium oxysporum)

QTPDKAKEQHPKLETYRCTKASGCKKQTNYIVADAGIHGIRQKNGAGCGD
WGQKPNATACPDEASCAKNCILSGMDSNAYKNAGITTSGNKLRLQQLINN
QLVSPRVYLLEENKKKYEMLHLTGTEFSFDVEMEKLPCGMNGALYLSEMP
QDGGKSTSRNSKAGAYYGAGYCDAQCYVTPFINGVGNIKGQGVCCNELDI
WEANSRATHIAPHPCSKPGLYGCTGDECGSSGICDKAGCGWNHNRINVTD
FYGRGKQYKVDSTRKFTVTSQFVANKQGDLIELHRHYIQDNKVIESAVVN
ISGPPKINFINDKYCAATGANEYMRLGGTKQMGDAMSRGMVLAMSVWWSE
GDFMAWLDQGVAGPCDATEGDPKNIVKVQPNPEVTFSNIRIGEIGSTS

3D structure

• PDB: 1ovw Structure of the Fusarium oxysporum endoglucanase I with a nonhydrolyzable substrate analogue: substrate distortion gives rise to the preferred axial orientation for the leaving group.
• Chain: B
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E197 D199 E202 H213
• Catalytic site (residue number reindexed from 1): E197 D199 E202 H213
• Enzyme Commision number: 3.2.1.4: cellulase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SSG	B	D199 E202 H209 H213 A237 W356	D199 E202 H209 H213 A237 W356
BS02	SGC	B	A143 Y145 D173 Q175 E197 D199 E202 W347	A143 Y145 D173 Q175 E197 D199 E202 W347
BS03	SGC	B	Y145 S345 W347	Y145 S345 W347

Gene Ontology

Molecular Function

• GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
• GO:0008810 cellulase activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0030245 cellulose catabolic process

External links

• PDB: RCSB:1ovw, PDBe:1ovw, PDBj:1ovw
• PDBsum: 1ovw
• PubMed: 8952478
• UniProt: P46237|GUNC_FUSOX Endoglucanase type C