Structure of PDB 1opb Chain B

Receptor sequence

>1opbB (length=133) Species: 10117 (Rattus rattus)

TKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIIVQDGDNFK
TKTNSTFRNYDLDFTVGVEFDEHTKGLDGRNVKTLVTWEGNTLVCVQKGE
KENRGWKQWVEGDKLYLELTCGDQVCRQVFKKK

3D structure

• PDB: 1opb Crystal structures of holo and apo-cellular retinol-binding protein II.
• Chain: B
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RET	B	F16 Q38 K40 W106 Q108 L117	F16 Q38 K40 W106 Q108 L117	MOAD: Kd=50nM

Gene Ontology

Molecular Function

• GO:0005504 fatty acid binding
• GO:0008289 lipid binding
• GO:0016918 retinal binding
• GO:0019841 retinol binding

Biological Process

• GO:0015908 fatty acid transport
• GO:0042572 retinol metabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1opb, PDBe:1opb, PDBj:1opb
• PDBsum: 1opb
• PubMed: 8487303
• UniProt: P06768|RET2_RAT Retinol-binding protein 2 (Gene Name=Rbp2)