Structure of PDB 1oko Chain B

Receptor sequence
>1okoB (length=121) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREH
PDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYND
VPGTYGNNSGSFSVNIGKDQS
3D structure
PDB1oko Structural Basis of Calcium and Galactose Recognition by the Lectin Pa-Il of Pseudomonas Aeruginosa
ChainB
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA B Y36 D100 T104 N107 N108 Y36 D100 T104 N107 N108
BS02 GLA B Y36 H50 Q53 D100 T104 N107 Y36 H50 Q53 D100 T104 N107 MOAD: Ka=34000M^-1
BS03 GAL B Y36 H50 Q53 D100 T104 N107 Y36 H50 Q53 D100 T104 N107 MOAD: Ka=34000M^-1
Gene Ontology
Molecular Function
GO:0030246 carbohydrate binding
Biological Process
GO:0007157 heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
Cellular Component
GO:0005737 cytoplasm
GO:0009986 cell surface
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1oko, PDBe:1oko, PDBj:1oko
PDBsum1oko
PubMed14644431
UniProtQ05097|PA1L_PSEAE PA-I galactophilic lectin (Gene Name=lecA)

[Back to BioLiP]