Structure of PDB 1ogy Chain B

Receptor sequence
>1ogyB (length=126) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]
DAPRLTGADRPMSEVAAPPLPETITDDRRVGRNYPEQPPVIPHSIEGYQL
SVNANRCLECHRRQYSGLVAAPMISITHFQDREGQMLADVSPRRYFCTAC
HVPQTNAQPLVTNEFRDMLTLMPASN
3D structure
PDB1ogy Structural and Redox Plasticity in the Heterodimeric Periplasmic Nitrate Reductase
ChainB
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC B R30 P40 I42 P43 H44 Y49 R57 C58 C61 H62 H102 R29 P39 I41 P42 H43 Y48 R56 C57 C60 H61 H101
BS02 HEC B R33 P36 E37 Q38 P40 H62 I75 H79 R95 C98 C101 H102 R32 P35 E36 Q37 P39 H61 I74 H78 R94 C97 C100 H101
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
Biological Process
GO:0009061 anaerobic respiration
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ogy, PDBe:1ogy, PDBj:1ogy
PDBsum1ogy
PubMed14528294
UniProtQ53177|NAPB_CERS4 Periplasmic nitrate reductase, electron transfer subunit (Gene Name=napB)

[Back to BioLiP]