Structure of PDB 1ofw Chain B

Receptor sequence

>1ofwB (length=292) Species: 876 (Desulfovibrio desulfuricans) [Search protein sequence]

AALEPTDSGAPSAIVMFPVGEKPNPKGAAMKPVVFNHLIHEKKIDNCETC
HHTGDPVSCSTCHTVEGKAEGNYITLDRAMHATNIAKRAKGNTPVSCVSC
HEQQTKERRECAGCHAIVTPKRDEAWCATCHNITPSMTPEQMQKGINGTL
LPGDNEALAAETVLAQKTVEPVSPMLAPYKVVIDALADKYEPSNFTHRRH
LTSLMERIKDDKLAQAFHNKPEILCATCHHRSPLSLTPPKCGSCHTKEID
KANPGRPNLMAAYHLQCMGCHKGMDVARPRDTDCTTCHKAAP

3D structure

PDB

1ofw Redox-Bohr and Other Cooperativity Effects in the Nine-Heme Cytochrome C from Desulfovibrio Desulfuricans Atcc 27774: Crystallographic and Modeling Studies

Chain

Resolution

1.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	B	A291 P292	A291 P292
BS02	HEC	B	S8 A10 I14 F35 H37 H40 I44 C47 C50 H51 P56 S58	S8 A10 I14 F35 H37 H40 I44 C47 C50 H51 P56 S58
BS03	HEC	B	H52 C59 C62 H63 E70 G71 I74 R78 A79 R88 P94 V95	H52 C59 C62 H63 E70 G71 I74 R78 A79 R88 P94 V95
BS04	HEC	B	F35 H40 C97 C100 H101 Q104 K212 L213	F35 H40 C97 C100 H101 Q104 K212 L213
BS05	HEC	B	T105 R108 C111 C114 H115 V118 P120 K121 R122 W126 I208 D211 F217 H218 I223 T227	T105 R108 C111 C114 H115 V118 P120 K121 R122 W126 I208 D211 F217 H218 I223 T227
BS06	HEC	B	M16 F17 P18 A29 M30 V33 M80 H81 C97 W126 C127 C130 H131	M16 F17 P18 A29 M30 V33 M80 H81 C97 W126 C127 C130 H131
BS07	HEC	B	A177 P178 F195 H197 C225 C228 H229 L236 K240 C241 Y263	A177 P178 F195 H197 C225 C228 H229 L236 K240 C241 Y263
BS08	HEC	B	H230 R231 C241 C244 H245 R256 P257 A262 Q266	H230 R231 C241 C244 H245 R256 P257 A262 Q266
BS09	HEC	B	F195 R199 H200 S203 R207 C267 C270 H271 M274 V276 P279 C287	F195 R199 H200 S203 R207 C267 C270 H271 M274 V276 P279 C287
BS10	HEC	B	I183 L186 A187 D188 K189 Y190 M260 Y263 H264 M268 H271 D281 C284 C287 H288	I183 L186 A187 D188 K189 Y190 M260 Y263 H264 M268 H271 D281 C284 C287 H288

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Cellular Component
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1ofw, PDBe:1ofw, PDBj:1ofw
PDBsum	1ofw
PubMed	12750363
UniProt	Q9RN68\|CYC9_DESDA Nine-heme cytochrome c (Gene Name=Ddes_2038)

[Back to BioLiP]