Structure of PDB 1odw Chain B |
>1odwB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGI GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 1odw Structural Analysis of the Native and Drug-Resistant HIV-1 Proteinases Complexed with an Aminodiol Inhibitor |
Chain | B |
Resolution | 2.1 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
0E8 |
B |
D25 G27 G49 |
D25 G27 G49 |
|
|
|
|