Structure of PDB 1ocu Chain B

Receptor sequence
>1ocuB (length=132) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
EPENFLEIEVHNPKTHIPNGMDSKGMFTDYEIICRTNLPSFHKRVSKVRR
RYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQG
LNTWMQSVAGHPLLQSGSKVLVRFIEAEKFVG
3D structure
PDB1ocu Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
ChainB
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PIB B R81 Y82 S83 E86 K112 I113 R118 R127 R51 Y52 S53 E56 K82 I83 R88 R97
Gene Ontology
Molecular Function
GO:0008289 lipid binding
GO:0032266 phosphatidylinositol-3-phosphate binding
GO:0035091 phosphatidylinositol binding
Biological Process
GO:0008104 protein localization
GO:0015031 protein transport
GO:0032456 endocytic recycling
GO:0034499 late endosome to Golgi transport
Cellular Component
GO:0000139 Golgi membrane
GO:0000329 fungal-type vacuole membrane
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0016020 membrane
GO:0030904 retromer complex
GO:0031901 early endosome membrane
GO:0032994 protein-lipid complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ocu, PDBe:1ocu, PDBj:1ocu
PDBsum1ocu
PubMed14514667
UniProtQ08826|SNX3_YEAST Sorting nexin-3 (Gene Name=SNX3)

[Back to BioLiP]