Structure of PDB 1o7k Chain B |
>1o7kB (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] |
TFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKT LKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMS LPTKISRCPHLLDFFKVRPD |
|
PDB | 1o7k Binding of the Px Domain of P47Phox to Phosphatidylinositol 3.4-Bisphosphate and Phosphatidic Acid is Masked by an Intramolecular Interaction |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SO4 |
B |
H51 K55 R70 H74 |
H48 K52 R67 H71 |
|
|
|
|