Structure of PDB 1o3y Chain B

Receptor sequence
>1o3yB (length=166) Species: 10090 (Mus musculus) [Search protein sequence]
GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV
WDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDE
LRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDG
LYEGLDWLSNQLRNQK
3D structure
PDB1o3y Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport
ChainB
Resolution1.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) L71
Catalytic site (residue number reindexed from 1) L56
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG B T31 T48 T16 T33
BS02 GTP B D26 A27 G29 K30 T31 T32 T45 P47 T48 G69 N126 K127 D129 L130 C159 A160 T161 D11 A12 G14 K15 T16 T17 T30 P32 T33 G54 N111 K112 D114 L115 C144 A145 T146
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019904 protein domain specific binding
Biological Process
GO:0002090 regulation of receptor internalization
GO:0006878 intracellular copper ion homeostasis
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0034315 regulation of Arp2/3 complex-mediated actin nucleation
GO:0060292 long-term synaptic depression
GO:0097061 dendritic spine organization
GO:0098586 cellular response to virus
GO:1990386 mitotic cleavage furrow ingression
Cellular Component
GO:0000139 Golgi membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0012505 endomembrane system
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030017 sarcomere
GO:0031252 cell leading edge
GO:0032991 protein-containing complex
GO:0043005 neuron projection
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1o3y, PDBe:1o3y, PDBj:1o3y
PDBsum1o3y
PubMed12679809
UniProtP84078|ARF1_MOUSE ADP-ribosylation factor 1 (Gene Name=Arf1)

[Back to BioLiP]