Structure of PDB 1o2f Chain B |
>1o2fB (length=77) Species: 562 (Escherichia coli) [Search protein sequence] |
EMAAALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVV VAGSGVQAIFGTKSDNLKTEMDEYIRN |
|
PDB | 1o2f Solution Structure of the Phosphoryl Transfer Complex between the Signal-transducing Protein IIAGlucose and the Cytoplasmic Domain of the Glucose Transporter IICBGlucose of the Escherichia coli Glucose Phosphotransferase System. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
2.7.1.199: protein-N(pi)-phosphohistidine--D-glucose phosphotransferase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PO3 |
B |
C335 I336 T337 |
C22 I23 T24 |
|
|
|
|