Structure of PDB 1nx0 Chain B

Receptor sequence
>1nx0B (length=173) Species: 9823 (Sus scrofa) [Search protein sequence]
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCR
SMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELP
GAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKS
LDKDGTGQIQVNIQEWLQLTMYS
3D structure
PDB1nx0 A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
ChainB
Resolution2.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) F462 G485 I487
Catalytic site (residue number reindexed from 1) F69 G92 I94
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B L406 V425 R428 H429 W466 K470 Q473 A474 K477 L13 V32 R35 H36 W73 K77 Q80 A81 K84
BS02 CA B A407 D410 E412 E417 A14 D17 E19 E24
BS03 CA B D450 D452 T454 K456 E461 D57 D59 T61 K63 E68
BS04 CA B D480 D482 S484 T486 E491 D87 D89 S91 T93 E98
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1nx0, PDBe:1nx0, PDBj:1nx0
PDBsum1nx0
PubMed12684003
UniProtP04574|CPNS1_PIG Calpain small subunit 1 (Gene Name=CAPNS1)

[Back to BioLiP]