Structure of PDB 1ns3 Chain B

Receptor sequence

>1ns3B (length=178) Species: 11105 (Hepatitis C virus (isolate BK))

ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVC
WTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSS
DLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVG
IFRAAVCTRGVAKAVDFVPVESMETTMR

3D structure

• PDB: 1ns3 Complex of NS3 protease and NS4A peptide of BK strain hepatitis C virus: a 2.2 A resolution structure in a hexagonal crystal form.
• Chain: B
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H55 D79 G135 S137
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	I3 T4 A5 Y6 S7 Q8 T10 R11 S20 E30 V33 Q34 V35 V36 S37 K62 T63 A65 W85 R92	I1 T2 A3 Y4 S5 Q6 T8 R9 S18 E28 V31 Q32 V33 V34 S35 K60 T61 A63 W83 R90

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:1ns3, PDBe:1ns3, PDBj:1ns3
• PDBsum: 1ns3
• PubMed: 9568891
• UniProt: P26663|POLG_HCVBK Genome polyprotein