Structure of PDB 1np8 Chain B

Receptor sequence
>1np8B (length=149) Species: 10116 (Rattus norvegicus) [Search protein sequence]
SEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTC
RSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNEL
PGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAF
3D structure
PDB1np8 A second binding site revealed by C-terminal truncation of calpain small subunit, a penta-EF-hand protein
ChainB
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) F580 G603 I605
Catalytic site (residue number reindexed from 1) F70 G93 I95
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CD B D568 D570 T572 K574 E579 D58 D60 T62 K64 E69
BS02 CD B D598 D600 S602 T604 E609 D88 D90 S92 T94 E99
BS03 CD B A525 D528 E530 E535 A15 D18 E20 E25
BS04 CD B D553 D641 D643 N644 D43 D131 D133 N134
BS05 CD B H547 D549 K595 H37 D39 K85
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1np8, PDBe:1np8, PDBj:1np8
PDBsum1np8
PubMed14579356
UniProtQ64537|CPNS1_RAT Calpain small subunit 1 (Gene Name=Capns1)

[Back to BioLiP]