Structure of PDB 1now Chain B

Receptor sequence
>1nowB (length=480) Species: 9606 (Homo sapiens) [Search protein sequence]
ALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGY
IFGTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGA
LRGLETFSQLVYQDSYGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKI
ILKTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYSLSHVYTP
NDVRMVIEYARLRGIRVLPEFDTPGHTLSWGKGQKDLLTPCYSLDSFGPI
NPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWESNPKIQDFMR
QKGFGTDFKKLESFYIQKVLDIIATINKGSIVWQEVFDDKAKLAPGTIVE
VWKDSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFG
GTQKQKQLFIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDM
DDAYDRLTRHRCRMVERGIAAQPLYAGYCN
3D structure
PDB1now Crystal structure of Human beta-hexosaminidase B: Understanding the molecular basis of Sandhoff and Tay-Sachs disease
ChainB
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D354 E355
Catalytic site (residue number reindexed from 1) D282 E283
Enzyme Commision number 3.2.1.52: beta-N-acetylhexosaminidase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 IFG B R211 D354 E355 W405 W424 Y450 D452 W489 E491 R143 D282 E283 W333 W352 Y378 D380 W417 E419
Gene Ontology
Molecular Function
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004563 beta-N-acetylhexosaminidase activity
GO:0005515 protein binding
GO:0008375 acetylglucosaminyltransferase activity
GO:0015929 hexosaminidase activity
GO:0016787 hydrolase activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0042802 identical protein binding
Biological Process
GO:0001501 skeletal system development
GO:0005975 carbohydrate metabolic process
GO:0006629 lipid metabolic process
GO:0006687 glycosphingolipid metabolic process
GO:0006689 ganglioside catabolic process
GO:0006874 intracellular calcium ion homeostasis
GO:0007040 lysosome organization
GO:0007338 single fertilization
GO:0007341 penetration of zona pellucida
GO:0007605 sensory perception of sound
GO:0007626 locomotory behavior
GO:0008049 male courtship behavior
GO:0008360 regulation of cell shape
GO:0008654 phospholipid biosynthetic process
GO:0009313 oligosaccharide catabolic process
GO:0019915 lipid storage
GO:0019953 sexual reproduction
GO:0030203 glycosaminoglycan metabolic process
GO:0030207 chondroitin sulfate catabolic process
GO:0030209 dermatan sulfate catabolic process
GO:0030214 hyaluronan catabolic process
GO:0042552 myelination
GO:0043615 astrocyte cell migration
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048477 oogenesis
GO:0050885 neuromuscular process controlling balance
GO:0050905 neuromuscular process
GO:0051651 maintenance of location in cell
GO:0070050 neuron cellular homeostasis
GO:1901135 carbohydrate derivative metabolic process
Cellular Component
GO:0001669 acrosomal vesicle
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005764 lysosome
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0035578 azurophil granule lumen
GO:0042582 azurophil granule
GO:0043202 lysosomal lumen
GO:0060473 cortical granule
GO:0070062 extracellular exosome
GO:1905379 beta-N-acetylhexosaminidase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1now, PDBe:1now, PDBj:1now
PDBsum1now
PubMed12662933
UniProtP07686|HEXB_HUMAN Beta-hexosaminidase subunit beta (Gene Name=HEXB)

[Back to BioLiP]