Structure of PDB 1nm5 Chain B

Receptor sequence

>1nm5B (length=358) Species: 1085 (Rhodospirillum rubrum)

MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDAL
TAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHL
GALTNRPVVEALTKRKITAYAMELMPRISRANSMDILSSQSNLAGYRAVI
DGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMA
TDVRAATKEQVESLGGKFITVEFRKKQAEAVLKELVKTDIAITTALIPGK
PAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVGH
TNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVTR
DGAIVHPA

3D structure

• PDB: 1nm5 Glutamine 132 in the NAD(H)-binding component of proton-translocating transhydrogenase tethers the nucleotides before hydride transfer.
• Chain: B
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R15 Q75 H99 G101 E123 R127 N132 D135 S138 E296
• Catalytic site (residue number reindexed from 1): R15 Q75 H99 G101 E123 R127 N132 D135 S138 E276
• Enzyme Commision number: 7.1.1.1: proton-translocating NAD(P)(+) transhydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	B	G181 V182 D202 V203 R204 L275	G181 V182 D202 V203 R204 L255	MOAD: Kd=20uM

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003957 NAD(P)+ transhydrogenase (Si-specific) activity
• GO:0005515 protein binding
• GO:0008750 proton-translocating NAD(P)+ transhydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0046983 protein dimerization activity
• GO:0050661 NADP binding
• GO:0051287 NAD binding
• GO:0070403 NAD+ binding
• GO:0070404 NADH binding

Biological Process

• GO:0006740 NADPH regeneration
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:1nm5, PDBe:1nm5, PDBj:1nm5
• PDBsum: 1nm5
• PubMed: 12564924
• UniProt: Q2RSB2|PNTAA_RHORT NAD(P) transhydrogenase subunit alpha part 1 (Gene Name=pntAA)