Structure of PDB 1ng3 Chain B

Receptor sequence

>1ng3B (length=364) Species: 1423 (Bacillus subtilis)

MKRHYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGRTTSAAAGML
GAHAECEERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFKLAF
SEEDVLQLRQMDDLDSVSWYSKEEVLEKEPYASGDIFGASFIQDDVHVEP
YFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWANHVVV
ASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTLYHDHCYIVPR
KSGRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPPIQNMKVDRFWAG
LRPGTKDGKPYIGRHPEDSRILFAAGHFRNGILLAPATGALISDLIMNKE
VNQDWLHAFRIDRK

3D structure

• PDB: 1ng3 Structural and Mechanistic Studies on ThiO, a Glycine Oxidase Essential for Thiamin Biosynthesis in Bacillus subtilis
• Chain: B
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): A47 G48 M49
• Catalytic site (residue number reindexed from 1): A47 G48 M49
• Enzyme Commision number: 1.4.3.19: glycine oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	G13 I15 F33 E34 S35 T42 T43 A46 A47 G48 M49 V174 S202 G203 W205 F209 G300 R302 F328 R329 N330 G331 I332 L333	G13 I15 F33 E34 S35 T42 T43 A46 A47 G48 M49 V174 S202 G203 W205 F209 G300 R302 F328 R329 N330 G331 I332 L333
BS02	AAC	B	M49 E55 R302 R329	M49 E55 R302 R329

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0043799 glycine oxidase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0071949 FAD binding

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0009228 thiamine biosynthetic process
• GO:0009229 thiamine diphosphate biosynthetic process
• GO:0009635 response to herbicide

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1ng3, PDBe:1ng3, PDBj:1ng3
• PDBsum: 1ng3
• PubMed: 12627963
• UniProt: O31616|GLYOX_BACSU Glycine oxidase (Gene Name=thiO)