Structure of PDB 1nfq Chain B

Receptor sequence
>1nfqB (length=244) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
SGRLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAMAAEL
ADAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYA
LTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVACH
GYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPEDIFQT
ALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVAGLAHN
3D structure
PDB1nfq Directed evolution approach to a structural genomics project: Rv2002 from Mycobacterium tuberculosis
ChainB
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G18 S140 Y153 K157
Catalytic site (residue number reindexed from 1) G17 S139 Y152 K156
Enzyme Commision number 1.1.1.53: 3alpha(or 20beta)-hydroxysteroid dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAI B G14 R17 G18 M19 D38 L40 L60 D61 V62 N88 I138 S140 Y153 K157 P183 V186 T188 P189 M190 T191 G13 R16 G17 M18 D37 L39 L59 D60 V61 N87 I137 S139 Y152 K156 P182 V185 T187 P188 M189 T190
BS02 AOI B L92 E142 C150 V194 I198 F199 L91 E141 C149 V193 I197 F198
Gene Ontology
Molecular Function
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0047044 androstan-3-alpha,17-beta-diol dehydrogenase activity
Biological Process
GO:0006706 steroid catabolic process
GO:0008202 steroid metabolic process
Cellular Component
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1nfq, PDBe:1nfq, PDBj:1nfq
PDBsum1nfq
PubMed12524453
UniProtP9WGT1|HSD_MYCTU 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase (Gene Name=fabG3)

[Back to BioLiP]