Structure of PDB 1nco Chain B

Receptor sequence

>1ncoB (length=113) Species: 1897 (Streptomyces carzinostaticus)

AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPA
DFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDA
AGNGPEGVAISFN

3D structure

• PDB: 1nco Crystal structure of neocarzinostatin, an antitumor protein-chromophore complex.
• Chain: B
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHR	B	G35 C37 L45 C47 P49 F52 F76 L77 F78 G80 Q94 G96 S98 G102	G35 C37 L45 C47 P49 F52 F76 L77 F78 G80 Q94 G96 S98 G102

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

Biological Process

• GO:0006952 defense response
• GO:0042742 defense response to bacterium

External links

• PDB: RCSB:1nco, PDBe:1nco, PDBj:1nco
• PDBsum: 1nco
• PubMed: 8235619
• UniProt: P0A3R9|NCZS_STRCZ Neocarzinostatin (Gene Name=ncsA)